GLUT4 Rabbit pAb

  • Sale
  • Regular price Dhs. 212.07
Shipping calculated at checkout.



Overview

Product name GLUT4 Rabbit pAb
Catalog No. A7637
Host species Rabbit
Purification method Affinity purification
Isotype IgG

  

Background

 This gene is a member of the solute carrier family 2 (facilitated glucose transporter) family and encodes a protein that functions as an insulin-regulated facilitative glucose transporter. In the absence of insulin, this integral membrane protein is sequestered within the cells of muscle and adipose tissue. Within minutes of insulin stimulation, the protein moves to the cell surface and begins to transport glucose across the cell membrane. Mutations in this gene have been associated with noninsulin-dependent diabetes mellitus (NIDDM).

Applications


Reactivity Human, Mouse, Rat
Tested applications WBIHCIF
Recommended dilution WB 1:500 - 1:2000
IHC 1:50 - 1:200
IF 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    
Positive samples HeLa, NIH/3T3, HepG2, Mouse kidney, Mouse heart, Rat heart, Rat kidney
Cellular location Cell membrane, Cytoplasm, Endomembrane system, Multi-pass membrane protein, perinuclear region
Customer validation

(Mouse heart tissue)

WB(Homo sapiens, Mus musculus)

IHC(Mesocricetus auratus)

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 400 to the C-terminus of human GLUT4 (NP_001033.1).
Sequence GPIPWFIVAELFSQGPRPAAMAVAGFSNWTSNFIIGMGFQYVAEAMGPYVFLLFAVLLLGFFIFTFLRVPETRGRTFDQISAAFHRTPSLLEQEVKPSTELEYLGPDEND
Gene ID 6517
Swiss prot P14672
Synonyms SLC2A4; GLUT4
Calculated MW 43kDa/54kDa
Observed MW

54kDa